Download free
a road with trees and grass on the side
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a road with trees and grass on the side

Download this free HD photo of grey, road, freeway, and highway by Abdul Zreika (@sandaproductions)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
Hd grey wallpapersroadfreewayhighwayasphalttarmactransportationvehicleautomobileCar images & picturesNature imagesoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20