Download free
a road with trees and fog
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a road with trees and fog

Download this free HD photo of background, summer, flower, and blossom in Russia by Alina Makhatyrova (@tfcygv79)

A map markerAltay, Russia
Calendar outlinedPublished on CameraOLYMPUS IMAGING CORP., XZ-1
SafetyFree to use under the Unsplash License
Hq background imagesSummer images & picturesFlower imagesblossomHd floral wallpapersfloristcolorfulbirch treerussian natureMountain images & pictureswildfreewayhighwaytarmacasphaltautomobileCar images & picturestransportationvehicleoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Dogs
52 images · Curated by Robert Schmitt
Dog images & picturesAnimals images & picturespet
Humanity
240 images · Curated by Jimmy Xander
humanityPeople images & pictureshuman
Happy Feet
114 images · Curated by Olivia Smith
le personepersonapiedi