Download free
a road with a white line
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a road with a white line

Download this free HD photo of road, sky, sun, and wallpaper by Kiril Georgiev (@kgeorgiev)

Calendar outlinedPublished on CameraSONY, ILCE-6400
SafetyFree to use under the Unsplash License
roadHd sky wallpapersSun images & picturesHd wallpapersviewLandscape images & picturesHd autumn wallpapersroadtripMountain images & picturesHd forest wallpapershighwayfreewaytarmacoutdoorsNature imageshorizonPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Hiver
40 images · Curated by Tania Dugas
hiverWinter images & picturesHd snow wallpapers
Garden
40 images · Curated by Jimmy Vanzino
gardenFlower imagesplant