Download free
a person with the hands on the head
– –––– –.
––– – ––– –––
– –––– –.
––– – ––– –––

a person with the hands on the head

Download this free HD photo of person, washing, water, and nature by HUUM (@huumsauna)

Calendar outlinedPublished on CameraSONY, ILCE-7M2
SafetyFree to use under the Unsplash License
People Images & PictureswashingHD Water WallpapersNature Imagesoutsidewashing outsidemanindoorslightingdetoxselfcarespadayhealthybodyhealthyskinhealthylivinghealthylifestylewoodheaterelectricheatersaunadesignsaunaPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20