Download free
a person holding a piece of fruit in their hand
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a person holding a piece of fruit in their hand

Download this free HD photo of fruit, brown, smoothie, and healthy by Alicia Christin Gerald (@allysphotos)

Calendar outlinedPublished on CameraCanon, EOS 750D
SafetyFree to use under the Unsplash License
Fruits images & picturesBrown backgroundssmoothiehealthycuttingfruitknifehealthylivingeatcleanplumplantFood images & picturesPeople images & pictureshumanpeachfingerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20