Download free
a narrow street lined with buildings and a clock tower
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a narrow street lined with buildings and a clock tower

Download this free HD photo of portugal, tomar, church, and calçada portuguesa in Tomar, Portugal by Sofia Vila Flor (@sofiavilaflor)

A map markerTomar, Portugal
Calendar outlinedPublished on Camerasamsung, SM-A307FN
SafetyFree to use under the Unsplash License
portugaltomarchurchcalçada portuguesabuildingsbuildingtownhome decoralleywayalleywalkwaypathflagstonePeople images & pictureshumanhigh risearchitecturetowerpavementHd windows wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20