Download free
a narrow alleyway in an old european city
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a narrow alleyway in an old european city

Download this free HD photo of urban, town, city, and street by Gabriel Tovar (@gabrielrana)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7500
SafetyFree to use under the Unsplash License
urbantownHd city wallpapersstreetroadpathwalkwayalleywayalleyflagstonecobblestonebuildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Nordic Countries
56 images · Curated by Petter Polson
swedenoutdoorHd grey wallpapers