Download free
a man and woman in black coats
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a man and woman in black coats

Download this free HD photo of bekasi, indonesia, west java, and military in Indonesia by Arfan Adytiya (@arfanbondenkz)

A map markerBekasi, West Java, Indonesia
Calendar outlinedPublished on CameraFUJIFILM, X-A3
SafetyFree to use under the Unsplash License
bekasiindonesiawest javamilitaryarmyprewedprewedding polisipolisishootinggunsdailyspecialforceseverydaycarrypolicetacticoolgunglocktacticalgeargunstacticalpolice preweddingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Natural wonders
353 images · Curated by Shawna Zylenko
naturaloutdoorHd grey wallpapers
Technology
176 images · Curated by Vladislav Vologzhin
technologyHd phone wallpapersHd iphone wallpapers
Peach
275 images · Curated by Renee Aumua
peachHd wallpapersoutdoor