Download free
a long empty road with mountains in the background
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Nature

a long empty road with mountains in the background

Road trip through California

A map markerCalifornia, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D3300
SafetyFree to use under the Unsplash License
usaCalifornia picturesHd grey wallpapersmountain roadSunset images & picturesroad triproadNature imagesasphalttarmacfreewayhighwayoutdoorsLandscape images & picturesHd scenery wallpaperslandHd sky wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Ultra Sounds Backgrounds
7,587 images · Curated by Ultra Sounds
Hd wallpapersfundonatureza
Creative work 1
67 images · Curated by Kara Mathieson
humanoutdoorplant
On the road again
119 images · Curated by Josie Weiss
roadoutdoorplant