Download free
a lion looking at the camera
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Color of Water
, Nature

a lion looking at the camera

Download this free HD photo of animal, nature, wallpapers, and backgrounds by Rob Potter (@robpotter)

Calendar outlinedPublished on CameraSONY, ILCE-7RM2
SafetyFree to use under the Unsplash License
Animals images & picturesNature imagesHd wallpapersHq background imagesLion imageswildlifesleepykingwildwildsportraitSpring images & picturesshadowhairasleepfurrypredatormammalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wallpapers
46 images · Curated by Carlos Porras
Hd wallpapersHq background imagesoutdoor
Animals
78 images · Curated by Susan Stewart
Animals images & picturesmammalwildlife