Download free
A group of people standing on top of a hill
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

A group of people standing on top of a hill

Download this free HD photo of land, portrait, photo, and human in China by Alan W (@alanw)

A map markerTibet, China
Calendar outlinedPublished on CameraSONY, ILCE-6000SafetyFree to use under the Unsplash License
landportraitphotohumanfacecloudgrassphotographychinahikingfieldsceneryadventureweatherwalkingoutdoorssoilcountrysidehorizongrasslandPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20