Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to shraga kopstein's profile
shraga kopstein
sfkopstein
Edit image Plus sign for Unsplash+
Download free
a group of black bugs crawling on a rock
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a group of black bugs crawling on a rock

I captured this swarm of ants busy doing what they do best.

Calendar outlinedPublished on April 30, 2024 (UTC)SafetyFree to use under the Unsplash License
animalblackwallgroupstoneoutdoorsmacroantsinsectsscratchcloseupcracksitchyswarmdaytimeinvertebratestextures and patternsbeeinsecthoney beePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20