Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Czapp Botond's profile
Czapp Botond
czapp_botond
Edit image Plus sign for Unsplash+
Download free
a giraffe stands in a zoo enclosure
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a giraffe stands in a zoo enclosure

Download this free HD photo of animal, illustration, cartoon, and grass by Czapp Botond (@czapp_botond)

A map markerNyíregyháza, Hungary
Calendar outlinedPublished on October 18, 2022 (UTC)CameraSafetyFree to use under the Unsplash License
animalillustrationcartoongrasswildlifeeyeparkchildyellowgiraffekenyazoomammalearwildernessnosecamouflagebigspotsleopardPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20