Download free
a foggy road in the middle of a forest
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Act For Nature

a foggy road in the middle of a forest

Download this free HD photo of france, road, nature, and trees in France by Clément Duguerre (@clementduguerre)

A map markerFrance
Calendar outlinedPublished on CameraCanon, EOS 80D
SafetyFree to use under the Unsplash License
franceroadNature imagesTree images & picturesmistphotographyfogfoggyoutdoorpositiveHd forest wallpapershighwayfreewaytarmacasphaltoutdoorspathPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

The Journey
11 images · Curated by Auguris
outdoorCloud pictures & imageshuman
France
284 images · Curated by phoenixx
franceoutdoorHd grey wallpapers
Landscape
189 images · Curated by Erica Stoddard
Landscape images & picturesoutdoorplant