Download free
a fire at night
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a fire at night

Download this free HD photo of miyar valley, himachal pradesh, flame, and bonfire in India by Jyoti Singh (@econut)

A map markerMiyar Valley, Himachal Pradesh
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D5300
SafetyFree to use under the Unsplash License
miyar valleyhimachal pradeshflamebonfirenight photographybonfire on mountainbonfire nightnight fireprimitive fireprimitivehimalayashimalayanatural fuelindiahimanchal pradeshhimanchalHd fire wallpapersPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections