Download free
a fighter jet sitting on top of an airport tarmac
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a fighter jet sitting on top of an airport tarmac

Lockheed Martin F-35 from the swiss army stands at sunset at Zurich Airport.

A map markerFlughafen Zürich (ZRH), Flughafenstrasse, Kloten, Schweiz
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D850
SafetyFree to use under the Unsplash License
schweizklotenflughafen zürich (zrh)flughafenstrasseAirplane pictures & imagesvehiclegrayflightflyingarmymilitaryswitzerlandpilotdramaticstealthwarplaneaircraftPeople images & picturesshoeairfieldPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Sea
186 images · Curated by Leonie Rixon
seaHd wave wallpapersoutdoor
THE ROAD LESS TRAVELLED
89 images · Curated by Hendri van Niekerk
roaddirt roadgravel