Download free
a duck standing on a sidewalk next to a body of water
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a duck standing on a sidewalk next to a body of water

Download this free HD photo of bird, water, goose, and wildlife birds in Detroit, United States by Walter Martin (@rise13law)

A map markerBelle Isle, Detroit, MI, USA
Calendar outlinedPublished on CameraCanon, EOS 6D Mark II
SafetyFree to use under the Unsplash License
Birds imagesHd water wallpapersgoosewildlife birdswildlifeislanddetroit riverriverpublic parkparkAnimals images & picturespathoutdoorswaterfowlpavementsidewalkasphalttarmacroadNature imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20