Download free
a curved road with a view of the ocean
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a curved road with a view of the ocean

Madeira mountains

Calendar outlinedPublished on CameraSony, a7III
SafetyFree to use under the Unsplash License
roadmounatinsmadeirafreewayhighwaytarmacasphaltbuildingbridgeoutdoorsNature imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Picture in picture
23 images · Curated by Tim Gouw
picturehandHd phone wallpapers
Portrait Mode
345 images · Curated by Mihir Sumant
portraitplantoutdoor