Download free
a cobblestone street with steps leading up to a building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a cobblestone street with steps leading up to a building

Download this free HD photo of kakopetria, cyprus, city, and road in Kakopetria, Cyprus by Kypros Georgiou (@kypros_georgiou89)

A map markerKakopetria, Cyprus
Calendar outlinedPublished on Camerasamsung, Galaxy S23 Ultra
SafetyFree to use under the Unsplash License
kakopetriacyprusHd city wallpapersroadurbanstreetpathwalkwayalleyflagstonecobblestoneoutdoorsNature imagescountrysideruralvillagehousingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Glorious Food
232 images · Curated by Heather Dou
Food images & picturesmealplant
Space
278 images · Curated by Peter Broomfield
Space images & picturesStar imagesoutdoor