Download free
a cobblestone street in a european city
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a cobblestone street in a european city

Download this free HD photo of estonia, tallinn, street, and city center in Tallinn, Estonia by Sercan Faiz (@derrauchfangkehrer)

A map markerTallinn, Estonia
Calendar outlinedPublished on CameraCanon, EOS 250D
SafetyFree to use under the Unsplash License
estoniatallinnstreetcity centerBeautiful pictures & imageshauptstadtcanonphotographbuildingsbaltic countrieseuropeaneuropean unioneuropaold townpathwalkwaypavementsidewalkcobblestonePeople images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20