Download free
a camera sitting on top of a table
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a camera sitting on top of a table

Black Fuji X100V with EF-X20 Flash on a desk.

Calendar outlinedPublished on CameraFUJIFILM, X70SafetyFree to use under the Unsplash License
photographycameradeskglassesdesignerflashelectronicsfilm photographystickersvideo camerafujifilmsketchbookblack cameracreative deskphotographic filmfujifilm x100vcompact camerax100vPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20