Download free
a boat docked in a harbor with other boats
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a boat docked in a harbor with other boats

Download this free HD photo of boat, harbor, ship, and baltics by Jevgeni Fil (@jecqan)

Calendar outlinedPublished on CameraCanon, EOS M100
SafetyFree to use under the Unsplash License
boatharborshipbalticsseasuurtolllennusadamestoniatallinnsunny dayferryHd water wallpaperssailboatvehiclepierwatercraftmarinaportPeople images & picturesoutdoorsPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Food & Drink
139 images · Curated by Claire Satera
drinkFood images & picturesplant
Minimal
369 images · Curated by Emilia K
minimalHd white wallpapersminimalism