Download free
a blue car parked on the side of a street
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a blue car parked on the side of a street

Das Panda.

A map markerNavigli, Milão, Itália
Calendar outlinedPublished on CameraCanon, EOS 250D
SafetyFree to use under the Unsplash License
milanomilanItaly pictures & imagesTourism picturesTravel imagesspokemachinevehicletirewheelsedansports carcoupePeople images & picturesurbanroadstreetneighborhoodwallhandbagPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Milano | Milan | Milão
40 images · Curated by Rui Alves
arquiteturacidademilão