Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to National Library of Scotland's profile
National Library of Scotland
natlibraryofscotland
Edit image Plus sign for Unsplash+
Download free
a black and white photo of men working on a tree
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

a black and white photo of men working on a tree

Download this free HD photo of man, animal, dog, and human by National Library of Scotland (@natlibraryofscotland)

Calendar outlinedPublished on June 4, 2024 (UTC)SafetyDual License: Public Domain & Unsplash License
mananimaldoghumangreyadulthorseboywarmalechildpetkidmammalheadcanine

Browse premium related images on iStock | Save 20% with code UNSPLASH20