Download free
a black and white photo of a walkway
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a black and white photo of a walkway

Download this free HD photo of patan durbar square, nepal, lalitpur, and palace in Lalitpur, Nepal by Sudip Ranjeet (@lycansu)

A map markerPatan Durbar Square, Lalitpur, Nepal
Calendar outlinedPublished on CameraSONY, ILCE-7M3
SafetyFree to use under the Unsplash License
patan durbar squarenepallalitpurpalacebalconyindoorsbuildingcorridorpathwalkwaysidewalkhandrailfloorflooringHd city wallpapershousingHouse imagesstaircasePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20