Download free
a bird sitting on top of a cement bench
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a bird sitting on top of a cement bench

Download this free HD photo of bulgaria, sofia, green, and grass in Sofia, Bulgaria by Georgi Kalaydzhiev (@jorok)

A map markerSofia, Bulgaria
Calendar outlinedPublished on CameraSONY, ILCE-7RM3
SafetyFree to use under the Unsplash License
bulgariasofiaHd green wallpapersGrass backgroundsmobile wallpaperHd wallpapersHd phone wallpapersSummer images & picturesexteriorlinesHq background imagesmobile backgroundlawnpathsidewalkpavementyardbackyardoutdoorsNature imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Textures
372 images · Curated by Dessa Bailey
Texture backgroundscroatiaHd pattern wallpapers
Mockup
269 images · Curated by Ivette Soto
mockupHd grey wallpapersminimal