Download free
red and white building during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

red and white building during daytime

Download this free HD photo of manhattan, new york, usa, and grey in New York, USA by Magnus Andersson (@mojacast)

A map markerDowntown, Manhattan, New York, USA
Calendar outlinedPublished on CameraSONY, ILCE-6300
SafetyFree to use under the Unsplash License
manhattanNew york pictures & imagesusaHd grey wallpapersskyscraperslostwandercityscapetrafficnycstreetwalkbuildingshighriseLife images & photosskylineHd wallpapershigh risesteepletarmacPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Northside #01
31 images · Curated by Axel Antas-Bergkvist
outdoorHd grey wallpapersHd snow wallpapers
Food & Drink
487 images · Curated by sd winter
drinkFood images & picturestable