Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Kay Dittner's profile
Kay Dittner
kays_kayos
Edit image Plus sign for Unsplash+
Download free
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Karlsruhe‘s subway as seen from inside a tram that‘s been in the rain

A map markerKarlsruhe, Karlsruhe, Germany
Calendar outlinedPublished on January 4, 2024 (UTC)CameraSafetyFree to use under the Unsplash License
subwaytunneltramtrackssubway tunnelgirlbuildinghumanfemaletrainvehiclechildgermanykidtrain stationrailwayrailterminaltrain trackkarlsruhePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20