Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of walkway, path, transportation, and car by Pedro Miranda (@pedromirandastudio)

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
walkwaypathtransportationCar images & picturesvehicleautomobilepavementsidewalkmachinewheeltarmacasphaltcoupesports carbuildingoutdoorslicense plateurbanHd city wallpaperstownPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Typography
200 images · Curated by Unsplash Archive
typographysignword