Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of mumbai, maharashtra, india, and skyhigh in Mumbai, India by Suriya (@blacklist_no_14_)

A map markerMumbai, Maharashtra, India
Calendar outlinedPublished on CameraGoogle, Pixel 6a
SafetyFree to use under the Unsplash License
mumbaimaharashtraindiaskyhighwingsairlinepixel 6agoogle pixelGoogle images & photoszhiyungimbalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

GoPro
76 images · Curated by Jeremy Bishop
goproaustraliaHd blue wallpapers
Law
80 images · Curated by Adam Klimowski
lawofficebusiness