Download free
a swiss army knife with a red handle
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a swiss army knife with a red handle

Victorinox knife MO. Nomad

A map markerTehran, Tehran Province, Iran
Calendar outlinedPublished on CameraFUJIFILM, GFX 50S
SafetyFree to use under the Unsplash License
tehran provincetehraniranknifecampingcampvictorinoxproduct photographyproductweaponbladedaggerdevicePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

100
93 images · Curated by Monique Haen
100outdoorCloud pictures & images
rain
38 images · Curated by sieun yoo
rainHd grey wallpapersdrop
Glasses
72 images · Curated by Eva Gafas
glassPeople images & pictureshuman