Download free
white and blue cloudy sky over the highway
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Feelings Images › Cool Images & Photos

white and blue cloudy sky over the highway

Road in the mountains, blue cloudy sky in the background

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7200
SafetyFree to use under the Unsplash License
roadHd sky wallpapersrocksstreetGrass backgroundsalpinescenicgravelMountain images & picturesCloud pictures & imagesasphalttarmachighwayfreewayoutdoorsNature imagesHd blue wallpaperscountrysideazure skyPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Still Waters
120 images · Curated by Sharon Scott
still waterlakereflection
Aerial Photos
663 images · Curated by Anton Rius
photoaerialaerial view