Download free
closeup photo of tennis net
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

closeup photo of tennis net

Download this free HD photo of tennis, blue, net, and sport by Ben Hershey (@benhershey)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D300
SafetyFree to use under the Unsplash License
tennisHd blue wallpapersnetSports imagesSports imagescourtgridHd green wallpapersfitgamelineplayplaygroundactivityHd abstract wallpapersgameslinesLove imagesAnimals images & picturesBirds imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Essex
614 images · Curated by Eleven01 Design
essexpovopessoa
Tennis
13 images · Curated by Ursie Downes
tenniSports imagestennis court