Download free
close-up photography person holding cards
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –
1,000,000+ Free Images › Feelings Images › Congratulations Images

close-up photography person holding cards

Download this free HD photo of green, grass, gray, and grey by Reagan Freeman (@rfree19)

Calendar outlinedPublished on CameraPanasonic, DC-GH5S
SafetyFree to use under the Unsplash License
Hd green wallpapersGrass backgroundsgrayHd grey wallpapersshirthandswatchHd city wallpapersHd black wallpapersHd yellow wallpapersHd gold wallpapersgardencardinvitemyrtle beachrailstextPeople images & pictureshumandocumentPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Other
57 images · Curated by Karen G
otherHq background imagesHd wallpapers
MOCKUPS
272 images · Curated by Urszula Panasiuk
mockupHq background imagesplant