Download free
blue and white glass walled building
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

blue and white glass walled building

Ghost way

A map markerPorte de Versailles - Parc des Expositions, Paris, France
Calendar outlinedPublished on CameraOlympus, OM 2
SafetyFree to use under the Unsplash License
Hd windows wallpapersbuildingarchitecturelinesemptyhallhallwayfilmfilm photographyshot on film35mmanalogflooringfloorbanisterhandrailcorridorrailinghousingdoorPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

umbrella
18 images · Curated by Anne-Catherine Chanterelle
umbrellaHd windows wallpapersbuilding
Chuck + Laura
206 images · Curated by Rebecca Mousseau
policehumanHd grey wallpapers
Pocketlaw
218 images · Curated by Isak de Jong
pocketlawla personneHumain