Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of gazimağusa, tree, urban, and building in Gazimağusa by irem akcaglayan (@iremakcaglayan)

A map markerGazimağusa, Gazimağusa
Calendar outlinedPublished on SafetyFree to use under the Unsplash License
gazimağusaTree images & picturesurbanbuildingoutdoorsPeople images & picturesNature imagesHd sky wallpapersutility polephotoofthedayphotographythebestofunsplashviewpalmtreepalmtreespalmpalmiyesunnySun images & picturesnaturalPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Cold Landscapes
145 images · Curated by Andy Muñoz
grigionaturanebbium