Download free
man in black jacket walking on road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

man in black jacket walking on road during daytime

Life is not a problem to be solved, but a reality to be experienced

Calendar outlinedPublished on CameraPanasonic, DC-GH5
SafetyFree to use under the Unsplash License
Brown backgroundstarmacasphaltroadPeople images & pictureshumanclothingapparelshoefootweardirt roadgravelfreewaywalkinghighwayautomobiletransportationvehicleCar images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Flowers, Nature, Whimsical
54 images · Curated by Ameli Antoinette
Flower imagesplantflora
Street style
110 images · Curated by charlesdeluvio
styleStreethuman