Download free
person writing on white paper
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial, Business & Work
1,000,000+ Free Images › Stock Photos & Images › Blogging Pictures

person writing on white paper

Download this free HD photo of document, contract, law, and graph in Nairobi, Kenya by Cytonn Photography (@cytonn_photography)

A map markerNairobi, Kenya
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750
SafetyFree to use under the Unsplash License
documentcontractlawgraphfinancingkenyanairobipie chartreport cardreportstrategyspreadsheetbusinessWebsite backgroundsPaper backgroundslegalblogHd white wallpaperstexthandwritingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Legal | Fujiwara and Rosenbaum LLLC
18 images · Curated by Fujiwara and Rosenbaum
legalBook images & photoslaw
Black Hands
125 images · Curated by Devin Stanfield
Hd black wallpapershandafrican american
Higher Education
339 images · Curated by Lauralee Flores
educationhumanstudent