Download free
low-angle photography of concrete post
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

low-angle photography of concrete post

Bottom up view on sightseeing tower nearby Treetop Walk in Black Forest, Germany.

A map markerPeter-Liebig-Weg 14, 75323 Bad Wildbad, Germany, Bad Wildbad
Calendar outlinedPublished on CameraSONY, ILCE-6000
SafetyFree to use under the Unsplash License
germanybad wildbad75323 bad wildbadpeter-liebig-weg 14buildingHd blue wallpapersblack forestbaumwipfelpfadschwarzwaldstructurebottom uparchitectureHd windows wallpapersmachinewheelskylightspoketirecar wheeltowerPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Wet
788 images · Curated by Tim Mossholder
wetoutdoorsea