Download free
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Download this free HD photo of automobile, building, architecture, and cafe in Reykjavík, Iceland by Lin Kehan (@linkehan)

A map markerTjarnarskóli, 101 Reykjavík, Iceland, Reykjavík
Calendar outlinedPublished on CameraApple, iPhone 8 Plus
SafetyFree to use under the Unsplash License
automobilebuildingarchitecturecafeAirplane pictures & imagesaircraftairlinerawningasphaltantique carbikebicyclecabinbulldozerbeaconantennaamusement parkbeveragealcoholarmchairPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20