Download free
soldiers and tanks
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

soldiers and tanks

Download this free HD photo of grey, army, tank, and vehicle by Kyppy84 (@kyppy84)

Calendar outlinedPublished on CameraSONY, ILCE-7
SafetyFree to use under the Unsplash License
Hd grey wallpapersarmytankvehiclemilitaryhumantransportationmilitary uniformPeople images & picturesarmoredGrass backgroundsplanttruckSmoke backgroundsweaponweaponrysoldiercannonPeople images & picturesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

New Zealand
126 images · Curated by Sholto Ramsay
new zealandoutdoorCloud pictures & images
EYE SEE YOU
1,171 images · Curated by Susan H.
œilles yeuxAnimals images & pictures