Download free
aerial photo of vehicles on road under dark sky near white buildings
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

aerial photo of vehicles on road under dark sky near white buildings

Highway intersection at night-time

Calendar outlinedPublished on SafetyFree to use under the Unsplash License
roadhighwaystreetnightCar images & picturesHd city wallpaperstraffictaxiurbanHd grey wallpapersfreewayasphalttarmactraffic jamvehiclecabautomobiletransportationtownbuildingPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Outdoors
25 photos · Curated by Cheyenne Eggert
outdoorHd grey wallpapersLight backgrounds
asia
81 photos · Curated by Sam Hendrix
asiumHd city wallpapersurban
Asia
42 photos · Curated by Hwee En Tan
asiumasianHd city wallpapers