Download free
white sail boat on sea during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

white sail boat on sea during daytime

Sailboat leaving the harbor in Holland, MI

A map markerHolland, MI, USA
Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D7500
SafetyFree to use under the Unsplash License
hollandmiusaHd grey wallpapersboatsailboatsailHd ocean wallpapersHd water wallpapersBeach images & picturespiermoodysailinglakemichiganlakevehicletransportationwatercraftvesselhumanPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Values
7 images · Curated by Heiko Haller
valuehumanHd grey wallpapers
Sailboats
13 images · Curated by Mary Annette Biszmaier
sailboatboatwatercraft
Ocean
243 images · Curated by Michael Loman
Hd ocean wallpapersyachttransportation