Download free
road between trees
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

road between trees

Download this free HD photo of united states, telluride, road, and journey in Telluride, United States by Kyle Cesmat (@kylecesmat)

A map markerTelluride, United States
Calendar outlinedPublished on CameraFUJIFILM, X100S
SafetyFree to use under the Unsplash License
united statestellurideroadjourneyroadtripwoodlandHd forest wallpapersTree images & picturesHd snow wallpaperswindingTree images & picturesduskmountain rangeSunset images & picturesstreetHd grey wallpapershighwayfreewaygraveldirt roadPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Road to...
79 images · Curated by Cati Y
roadoutdoorHd forest wallpapers
Road Trip Adventures
10 images · Curated by Kiernan McCranie
adventureroadoutdoor
Composer
1,806 images · Curated by composer
composereducationBook images & photos