Download free
a road with a mountain in the background
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

a road with a mountain in the background

Download this free HD photo of road, grey, nature, and scotland by Yousef Espanioly (@yespanioly)

Calendar outlinedPublished on CameraNIKON CORPORATION, NIKON D750
SafetyFree to use under the Unsplash License
roadHd grey wallpapersNature imagesscotlandcolor gradingdramaticstreetMountain images & picturesviewLandscape images & picturesHd wallpapersHd sky wallpapersfreewayhighwayasphalttarmacsolar panelselectrical devicePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

UK Road
1,691 images · Curated by Iain Moore
ukroadstreet
uk
773 images · Curated by tcpics
ukoutdoorscotland
Speed
41 images · Curated by Iain Moore
speedCar images & picturesvehicle