Download free
empty road during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

empty road during daytime

Download this free HD photo of grey, road, highway, and freeway by Arun Clarke (@arunclarke)

Calendar outlinedPublished on CameraSONY, ILCE-7RM3
SafetyFree to use under the Unsplash License
Hd grey wallpapersroadhighwayfreewaytarmacasphaltabiesplantfirTree images & picturesgraveldirt roadconiferPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

ROAD
661 images · Curated by Isla MA
roadoutdoorgravel
Roads
25 images · Curated by Trevor McKinnon
roadHd grey wallpapersgravel
road
27 images · Curated by stein oukes
roadgraveldirt road