Download free
brown bison near body water during daytime
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial

brown bison near body water during daytime

Download this free HD photo of animal, bison, bull, and lake in Amstelveen, Nederland by Luuk Timmermans (@luukati)

A map markerAmsterdamse Bos, Amstelveen, Nederland
Calendar outlinedPublished on CameraCanon, EOS 70D
SafetyFree to use under the Unsplash License
Animals images & picturesbisonbulllakeTree images & pictureshighland cattledutchHd forest wallpaperslonghornwild animalAnimals images & picturesbuffalohornswildernessmammalyakvegetationplantflorabushPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Animals
372 images · Curated by Peter Broomfield
Animals images & pictureswildlifeHd grey wallpapers
ReW
61 images · Curated by Lindsay Pohl-Hanzlik
rewAnimals images & picturesHd grey wallpapers