Unsplash logoUnsplash HomeA photoPen Tool
A compassA stack of foldersDownload
Bookmark
Person
Get Unsplash+Log in
Go to Yoyo Hins Itta's profile
Yoyo Hins Itta
Available for hireA checkmark inside of a circle
Edit image Plus sign for Unsplash+
Download free
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

A traveling woman watches her phone at Surabaya Gubeng train station, Indonesia.

A map markerStasiun Gubeng, Jalan Stasiun Gubeng, Pacar Keling, Surabaya, East Java, Indonesia
Calendar outlinedPublished on June 21, 2023 (UTC)CameraSafetyFree to use under the Unsplash License
womanbusinesscityroadstreettrainwalkingvacationbusiness womanpathroad triptrain stationrailwayticketrailingpassengertravel womanpassenger traintraveling womanfemalePublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20