Unsplash logoUnsplash HomeA photoPen Tool
A compass
Person
Get Unsplash+Log in
Go to Public domain vectors's profile
Public domain vectors
publicdomainvectors
Edit image Plus sign for Unsplash+
Three compartments with cash and coins
––– –– ––
––– –––– ––––
––– –– ––
––– –––– ––––

Three compartments with cash and coins

Download this free illustration of money, illustration, vector, and investment by Public domain vectors (@publicdomainvectors)

Calendar outlinedPublished on February 10, 2026 (UTC)SafetyDual License: Public Domain & Unsplash License
moneyillustrationvectorinvestmenteconomypaymentfinancialwealthcashfinancial planningsavingscoinscurrencybudgetingfinancial servicestransactioncommercefinancial freedomfinancial literacyfinancial growthCreative Commons images

Browse premium related images on iStock | Save 20% with code UNSPLASH20