Download free
woman walking on grass field
– –– ––––
––– – ––– – –
– –– ––––
––– – ––– – –

Featured in

Editorial
1,000,000+ Free Images › People Images & Pictures

woman walking on grass field

Download this free HD photo of behind, strap, shirt, and track in Hitchin, United Kingdom by Clem Onojeghuo (@clemono)

A map markerHitchin, United Kingdom
Calendar outlinedPublished on CameraCanon, EOS 5D Mark II
SafetyFree to use under the Unsplash License
behindstrapshirttrackwalkingladyfashionagriculturemazeruralgrainmeadowescapemoodycountrysidewheatfieldmodelfarmCover photos & imagesPublic domain images

Browse premium related images on iStock | Save 20% with code UNSPLASH20

Related collections

Pattern
18 images · Curated by Shreshtha Jangid
Hd pattern wallpapersFlower imagesplant
DHT ws
43 images · Curated by Vanessa Sokalik
Hq background imagesHd wallpapersHd color wallpapers